General Information

  • ID:  hor000730
  • Uniprot ID:  Q03517
  • Protein name:  Secretogranin 2
  • Gene name:  Scg2
  • Organism:  Mus musculus (Mouse)
  • Family:  Chromogranin/secretogranin protein family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005125 cytokine activity; GO:0042056 chemoattractant activity
  • GO BP:  GO:0000165 MAPK cascade; GO:0001525 angiogenesis; GO:0001938 positive regulation of endothelial cell proliferation; GO:0035556 intracellular signal transduction; GO:0048245 eosinophil chemotaxis; GO:0050918 positive chemotaxis; GO:0050930 induction of positive chemotaxis; GO:2000352 negative regulation of endothelial cell apoptotic process; GO:2001237 negative regulation of extrinsic apoptotic signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule; GO:0031045 dense core granule; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  ESKDQLSEDASKVITYL
  • Length:  17(300-316)
  • Propeptide:  MAGAKAYRLGAVLLLIHLIFLISGAEAASFQRNQLLQKEPDLRLENVQKFPSPEMIRALEYIEKLRQQAHREESSPDYNPYQGVSVPLQLKENGEESHLAESSRDALSEDEWMRIILEALRQAENEPPSAPKENKPYALNLEKNFPVDTPDDYETQQWPERKLKHMRFPLMYEENSRENPFKRTNEIVEEQYTPQSLATLESVFQELGKLTGPSNQKRERVDEEQKLYTDDEDDVYKTNNIAYEDVVGGEDWSPI
  • Signal peptide:  MAGAKAYRLGAVLLLIHLIFLISGAEAASF
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuroendocrine protein of the granin family that regulates the biogenesis of secretory granules.
  • Mechanism:  Binds calcium with a low-affinity.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q03517-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000730_AF2.pdbhor000730_ESM.pdb

Physical Information

Mass: 221168 Formula: C83H136N20O32
Absent amino acids: CFGHMNPRW Common amino acids: S
pI: 4.11 Basic residues: 2
Polar residues: 5 Hydrophobic residues: 5
Hydrophobicity: -68.24 Boman Index: -4000
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 91.76
Instability Index: 3840.59 Extinction Coefficient cystines: 1490
Absorbance 280nm: 93.13

Literature

  • PubMed ID:  12716136
  • Title:  Peptidomics-based Discovery of Novel Neuropeptides